INF7TAT acetate
Based on 1 Customer Validation
INF7TAT acetate is an amphipathic cell-penetrating peptide that mediates intracellular delivery of CRISPR ribonucleoproteins. INF7TAT acetate achieves endosomal escape via the INF7 fragment and cell binding via the TAT fragment. It enables intracellular delivery into primary human T cells and hematopoietic stem and progenitor cells, facilitating gene knockout and AAV-mediated homology-directed repair. INF7TAT acetate can be used for genome editing-related research.
For research use only. We do not sell to patients.
- Formula: C179H268N54O48S·xC2H4O2
- Molecular Weight:3976.44 (free base)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Protocols
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Description
In Vitro
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 3976.44 (free base)
-
Formula C179H268N54O48S·xC2H4O2
-
SMILES
O=C(N[C@@H](CC(C)C)C(N[C@@H](CC1=CC=CC=C1)C(N[C@@H](CCC(O)=O)C(N[C@@H](C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H](CC2=CC=CC=C2)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC(N)=O)C(NCC(N[C@@H](CC3=CNC4=CC=CC=C34)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H](CCSC)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC(O)=O)C(NCC(N[C@@H](CC5=CNC6=CC=CC=C56)C(N[C@@H](CC7=CC=C(C=C7)O)C(NCC(N[C@@H](CC8=CC=C(C=C8)O)C(NCC(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](CCCCN)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CN
-
Sequence
Gly-Leu-Phe-Glu-Ala-Ile-Glu-Gly-Phe-Ile-Glu-Asn-Gly-Trp-Glu-Gly-Met-Ile-Asp-Gly-Trp-Tyr-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg
-
Sequence Shortening
GLFEAIEGFIENGWEGMIDGWYGYGRKKRRQRR
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
H2O : 25 mg/mL (Need ultrasonic)
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
INF7TAT acetate Related Classifications
HY-P11000A Related Classifications
Powered by Bioz