Peptide YY (PYY) (3-36), Human
Based on 1 Customer Validation
Peptide YY (PYY) (3-36), Human is an endogenous appetite-suppressing peptide that acts as a selective agonist of neuropeptide Y (NPY) Y2 receptor. Peptide YY (PYY) (3-36), Human inhibits intestinal fluid secretion, colonic propulsion, and reduces fecal output in mouse models. Peptide YY (PYY) (3-36), Human inhibits dmPGE2-, 5HT (HY-B1473A)-, and Castor oil (HY-107799)-induced diarrhea in mice. Peptide YY (PYY) (3-36), Human improves metabolic parameters and mitochondrial function in obese rat MASLD models. Peptide YY (PYY) (3-36), Human can be used for research on intestinal diseases such as diarrhea and metabolic dysfunction-associated steatotic liver disease.
For research use only. We do not sell to patients.
- Purity : 98.05%
- CAS No.: 123583-37-9
- Formula: C180H279N53O54
- Molecular Weight:4049.45
-
Storage:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Protocols
- Purity & Documentation
- References
-
Help & FAQs
-
HY-P1514
Peptide YY (PYY), humanGut Hormone -
HY-13629
EtoposideTopoisomerase II Inhibitor -
HY-P0252
α-MSHMC4R Agonist -
HY-114118
SemaglutideGLP-1R Agonist -
HY-106224
Orexin A (human, rat, mouse)Orexin Receptor Agonist -
HY-P0198
Neuropeptide Y (human,rat,mouse)Active Compound -
HY-P0185
Endomorphin 1μ-Opioid Receptor Agonist -
HY-113893
β-Interleukin I (163-171), humanIL-1β Peptide
All Neuropeptide Y Receptor Isoforms
More
Biological Activity
Description
IC50 & Target
[1]|
NPY Y2 receptor |
In Vivo
Peptide YY (PYY) (3-36), Human (1 mg/kg; i.p.; single dose) significantly blocks dmPGE2-induced intestinal fluid accumulation in mice[1].
Peptide YY (PYY) (3-36), Human (0.01-1 mg/kg; i.p.; single dose) dose-dependently reduces normal fecal output in mice and increases colonic bead expulsion time in mice, indicating inhibition of colonic propulsion[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:C57BL/6J (male, 13-19 weeks old)[1]
-
Dosage:0.01, 0.1, 1 mg/kg
-
Administration:i.p.; single dose
-
Result:Inhibited dmPGE2-induced diarrhea dose-dependently from 0.01-1 mg/kg.
Completely blocked the diarrhea model at 1 mg/kg.\nInhibited 5HT-induced diarrhea dose-dependently from 0.01-1 mg/kg.
Completely blocked the diarrhea model at 1 mg/kg.\nSignificantly and dose-dependently inhibited castor oil-induced diarrhea from 0.01-1 mg/kg.
-
Animal Model:C57BL/6J (male, 13-19 weeks old)[1]
-
Dosage:1 mg/kg
-
Administration:i.p.; single dose
-
Result:Did not alter basal fluid content.
Significantly blocked dmPGE2-induced fluid accumulation by 64%.
-
Animal Model:C57BL/6J (male, 13-19 weeks old)[1]
-
Dosage:0.01, 0.1, 1 mg/kg
-
Administration:i.p.; single dose
-
Result:Reduced wet fecal weights by 50%, 77% and 89% over 1 h at 0.01, 0.1 and 1 mg/kg, respectively.
Reduced wet fecal weights by 22%, 60% and 83% over 4 h at 0.01, 0.1 and 1 mg/kg, respectively.
Increased the time for bead expulsion from the colon relative to vehicle control at 1 mg/kg.
-
Animal Model:Wistar (Male, 6 weeks old, HFHC diet plus L-NAME)[2]
-
Dosage:0.015 mol/kg/day
-
Administration:osmotic pump; continuous; 8 weeks
-
Result:Did not yield any weight reduction (body weight unchanged vs.
MASLD).
Reduced the HOMA index vs.
MASLD.
Exhibited a significant reduction in mitochondrial O2 consumption compared with MASLD (state 3 with 1 mM ADP), rescuing consumption levels to those of healthy controls.
Demonstrated a significant reduction in respiration rate in the FA state 3u (uncoupled state with DNP).
Significantly reduced MCAD and PPAR protein expression compared with MASLD.
Restored PPAR levels.
Significantly reduced Ndufb8 and elevated MTCO1 in isolated hepatic mitochondria compared with MASLD.
Led to a significant reduction of TNF-α mRNA expression.
Significantly lowered IL-1β mRNA expression compared with MASLD.
Chemical Information
-
CAS No. 123583-37-9
-
Appearance Solid
-
Molecular Weight 4049.45
-
Formula C180H279N53O54
-
Color White to off-white
-
Sequence
Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
-
Sequence Shortening
IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Solvent & Solubility
In Vitro:
DMSO : 25 mg/mL (6.17 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (302 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2469 mL | 1.2347 mL | 2.4695 mL | 6.1737 mL |
| 5 mM | 0.0494 mL | 0.2469 mL | 0.4939 mL | 1.2347 mL |
Peptide YY (PYY) (3-36), Human Related Classifications
HY-P10000 Related Classifications
Powered by Bioz
Keywords