BMP-4 Protein, Human (E399D)
BMP-4 Protein, Human (E399D) is the recombinant human-derived BMP-4 protein, expressed by E. coli, with tag free tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BMP-4 Protein, Human (E399D) is the recombinant human-derived BMP-4 protein, expressed by E. coli, with tag free tag.
Background
The BMP-4 protein is predicted to have BMP receptor binding activity and cytokine activity, playing a crucial role in various processes such as animal organ development, determination of bilateral symmetry, and embryonic morphogenesis. It is expected to be located in the extracellular region and active in the extracellular space. The expression of BMP-4 is observed in several structures, including the cardiovascular system, fin, head, inner ear, and mesoderm. In humans, this gene's orthologs have been implicated in several diseases, such as CAKUT (multiple), cleft lip, orofacial cleft 11, ossification of the posterior longitudinal ligament of the spine, and otosclerosis. The human BMP4 gene serves as the orthologous counterpart to the BMP-4 protein. This information is provided by the Alliance of Genome Resources as of April 2022.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P12644 (S293-R408, E399D)
-
Gene ID652
-
Molecular Construction
-
N-term
-
BMP-4 (S293-R408, E399D)
Accession # P12644 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
BMP4; MCOPS6; Prev. BMP2B; OFC11; Bone Morphogenetic Protein 2B; BMP-4; Bone Morphogenetic Protein 4 Preproprotein; ZYME; Alternative Protein BMP4; DVR4; BMP2B1; Bone Morphogenetic Protein 4; BMP-2B
-
AA Sequence
SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQDMVVEGCGCR
-
Predicted Molecular Mass
13.3 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
