SDF-1α (human) TFA
Based on 2 publication(s) in Google Scholar
SDF-1α (human) TFA is an endogenous CXC chemokine and the primary natural ligand of CXCR4. SDF-1α (human) TFA activates Gαi, MAP kinase, β-arrestin, and JAK/STAT signaling pathways, promoting chemotaxis of CXCR4-positive cells. SDF-1α (human) TFA induces receptor internalization and promotes cancer cell migration and invasion. SDF-1α (human) TFA promotes dental pulp cell migration and is required for osteogenesis, angiogenesis, and neurogenesis of dental pulp cells. SDF-1α (human) TFA is used in research on CXCR4-mediated diseases, such as cancer and cardiovascular diseases.
For research use only. We do not sell to patients.
- Purity : 98.89%
- Formula: C356H578N106O93S4.xC2HF3O2
- Molecular Weight:7959.34 (free acid)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Protocols
- Purity & Documentation
- References
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) SDF-1α (human) TFA
MoreAll Arrestin Isoforms
MoreAll Endogenous Metabolite Isoforms
More
Biological Activity
Description
IC50 & Target
[1]|
CXCR4 |
In Vitro
SDF-1α (human) (0.76-4.91 nM) TFA activates Gi signaling in wild-type and mutant CXCR4-expressing cells in BRET assays[2].
SDF-1α (human) (10×10-9 M; 1 h) TFA can serve as an experimental stimulus and negative control condition for CXCR4 internalization in U2OS cells stably expressing EGFP-CXCR4[3].
SDF-1α (human) (200 ng/mL) TFA reduces the DPC growth rate[4].
SDF-1α (human) (50-100 ng/mL; 24 h) TFA promotes DPC migration[4].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:human dental pulp cells (DPCs)
-
Concentration:50, 100 ng/mL
-
Incubation Time:24 h
-
Result:Promoted DPC migration in transwell and scratch assays, with approximately 2.0-fold and 2.7-fold increases at 50 and 100 ng/mL, respectively.
- Scratch/Wound-Healing Migration Assay
- Human pluripotent stem cell endothelial-cell differentiation
- Vascular/Branching Fractal Analysis
- Cell migration
- Neural Crest/Neuronal Cell Migration Explant Assay
- Cell differentiation
- Zigmond Chamber Chemotaxis Assay
- Mesenchymal stromal/stem cell osteogenic differentiation
- Under-Agarose Cell Migration Assay
- Transwell/Boyden Chamber Migration Assay
- Endothelial Tube Formation Assay
- SH-SY5Y neuronal-like differentiation
- 3D Collagen/Hydrogel Matrix Migration Assay
- Cell invasion
- Dunn/Insall Chamber Chemotaxis Assay
- Cell-Exclusion Zone Migration Assay
- Endothelial Cell Migration/Angiogenic Sprouting Assay
Chemical Information
-
Appearance Solid
-
Molecular Weight 7959.34 (free acid)
-
Formula C356H578N106O93S4.xC2HF3O2
-
Color White to off-white
-
Sequence
Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Ala-Leu-Asn-Lys (Disulfide bridge:Cys9-Cys34;Cys11-Cys50)
-
Sequence Shortening
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK (Disulfide bridge:Cys9-Cys34;Cys11-Cys50)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
-
ACS Appl Mater Interfaces
Advanced Strategies in Bone Tissue Engineering: "Membrane-Jelly" Hydrogel System to Improve Bone Marrow Stem Cell Osteogenic Differentiation and Bone Regeneration. [Abstract]2025 Jun 18;17(24):34982-34996. PMID: 40492576
Solvent & Solubility
In Vitro:
DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Purity & Documentation
-
Data Sheet (313 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Gaonkar RH, et al. Development of a New Class of CXCR4-Targeting Radioligands Based on the Endogenous Antagonist EPI-X4 for Oncological Applications. Journal of medicinal chemistry. 2023 Jul 13;66(13):8484-8497. [Content Brief]
[2]. Katzman BM, et al. Tetrahydroisoquinoline CXCR4 Antagonists Adopt a Hybrid Binding Mode within the Peptide Subpocket of the CXCR4 Receptor. ACS medicinal chemistry letters. 2019 Jan 10;10(1):67-73. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
SDF-1α (human) TFA Related Classifications
HY-P4911A Related Classifications
Powered by Bioz