Scientific Reviews
Product Guides
Blogs
Topics
Targeted therapy! The Capetin Prize winning "Click Chemistry" can be used like this!Targeted therapy! The Nobel Prize winning "Click Chemistry" can be used like this!2025-02-06
27 Results for "
human CCR5
" in MedChemExpress (MCE) Product Catalog:
Products (27)
27 Results for "human CCR5" in MCE Product Catalog:
65
65 Publications Verification
Synonyms: UK-427857
Research Areas:
Maraviroc (UK-427857) is a selective CCR5 antagonist with activity against human HIV.
30
30 Cited Publications
Synonyms: ZK-811752 hydrochloride
Target:
Research Areas:
BX471 hydrochloride (ZK-811752 hydrochloride) is a potent, selective non-peptide CCR1 antagonist with Ki of 1 nM for human CCR1, and exhibits 250-fold selectivity for CCR1 over CCR2, CCR5 and CXCR4.
4
4 Cited Publications
Target:
Research Areas:
J-113863 is a potent and selective CCR1 antagonist with IC50 values of 0.9 nM and 5.8 nM for human and mouse CCR1 receptors, respectively. J-113863 is also a potent antagonist of the human CCR3 (IC50 of 0.58 nM) , but a weak antagonist of the mouse CCR3 (IC50 of 460 nM). J-113863 is inactive against CCR2, CCR4 and CCR5, as well as the LTB4 or TNF-α receptors. Anti-inflammatory effect .
2
2 Cited Publications
Cat. No.: HY-P80385
Synonyms: C C chemokine receptor type 2 antibody;
C C CKR 2 antibody;
C-C chemokine receptor type 2 antibody;
C-C CKR-2 antibody;
CC chemokine receptor type 2 antibody;
CC CKR 2 antibody;
CC-CKR-2 antibody;
CCCKR2 antibody;
CCR 2 antibody;
CCR-2 antibody;
CCR1L antibody;
CCR2 antibody;
CCR2_human antibody;
CCR2A antibody;
CCR2B antibody;
CCR5L antibody;
CD192 antibody;
CD192 antigen antibody;
Chemokine C C motif receptor 2 antibody;
Chemokine CC Motif Receptor 2 antibody;
CKR 2 antibody;
CKR2 antibody;
CKR2A antibody;
CKR2B antibody;
CMKBR2 antibody;
MCP 1 R antibody;
MCP-1-R antibody;
MCP1 RECEPTOR antibody;
MCP1R antibody;
Monocyte chemoattractant protein 1 receptor antibody;
Monocyte Chemotactic Protein 1 Receptor antibody;
Monocyte Chemotactic Protein 1 Receptor antibody
1
1 Cited Publications
Target:
Research Areas:
AZD-5672 is an orally active, potent, and selective CCR5 antagonist (IC50=0.32 nM). AZD-5672 shows moderate activity against the hERG ion channel (binding IC50=7.3 μM). AZD5672 is a substrate of human P-gp, and inhibits P-gp-mediated digoxin transport (IC50=32 μM). AZD-5672 can be used for the research of rheumatoid arthritis .
Cat. No.: HY-P4191A
Target:
Research Areas:
Cat. No.: HY-117621
CAS No.: 1228111-63-4
Target:
Research Areas:
PF-0463481 is a potent and orally active dual CCR2/CCR5 antagonist with comparable human and rodent CCR2 potency (rat IC50=20.8 nM), and displays 10-20 fold less rodent CCR5 potency (rat IC50=470 nM). PF-0463481 is safe and well-tolerated and has the potential for the study of diabetic nephropathy .
Target:
Research Areas:
PF-0463481 succinate is a potent and orally active dual CCR2/CCR5 antagonist with comparable human and rodent CCR2 potency (rat IC50=20.8 nM), and displays 10-20 fold less rodent CCR5 potency (rat IC50=470 nM). PF-0463481 succinate is safe and well-tolerated and has the potential for the study of diabetic nephropathy .
Cat. No.: HY-RS02160
Target:
Research Areas:
CCR5 Human Pre-designed siRNA Set A contains three designed siRNAs for CCR5 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.
Cat. No.: HY-106055
CAS No.: 74817-61-1
Research Areas:
Murabutide is an immunomodulator and also a NOD2 receptor agonist . Murabutide enhances the signal transduction of ATR and NOD2, mediates the activation of the DDR pathway, and thereby repairs radiation-induced DNA double-strand breaks. Murabutide inhibits radiation-induced cell apoptosis and protects cells and mice from radiation-induced toxic damage. Murabutide induces the expression and DNA-binding activity of Oct-1 in macrophages, thereby inhibiting the transcription and replication of HIV-1. Murabutide reduces the expression levels of CD4 and CCR5 on the surface of macrophages, and induces the secretion of β-chemokines, TNF-α and IL-6. Murabutide enhances non-specific viral resistance and targets reticuloendothelial cells. Murabutide can be used in research related to radiation-induced damage and human immunodeficiency virus type 1 infection .
Cat. No.: HY-13004S
CAS No.: 1033699-22-7
Cat. No.: HY-174743
Target:
Research Areas:
Human CCR5 mRNA encodes the human C-C motif chemokine receptor 5 (CCR5) protein, a member of the beta chemokine receptor family. CCR5 is known to be an important co-receptor for macrophage-tropic virus, including HIV, to enter host cells. It may also play a role in granulocyte lineage proliferation and differentiation.
Cat. No.: HY-P991541
Cat. No.: HY-13004R
CAS No.: 376348-65-1
Synonyms: UK-427857 (Standard)
Target:
Research Areas:
Maraviroc (Standard) is the analytical standard of Maraviroc. This product is intended for research and analytical applications. Maraviroc (UK-427857) is a selective CCR5 antagonist with activity against human HIV.
Cat. No.: HY-P4191
CAS No.: 1883816-50-9
Synonyms: MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
Target:
Research Areas:
Cat. No.: HY-B0155
CAS No.: 306296-47-9
Synonyms: SCH 417690; SCH-D; MK-7690 free base
Vicriviroc (SCH 417690) is an orally active CCR5 antagonist with the IC50 of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC50 values of 0.91 nM and 16 nM,,respectively. Vicriviroc can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer .
Cat. No.: HY-174753
Target:
Research Areas:
Human CCL3L1 mRNA encodes the human C-C motif chemokine ligand 3 like 1 (CCL3L1) protein. It is a ligand for CCR1, CCR3 and CCR5.
Cat. No.: HY-174752
Target:
Research Areas:
Human CCL4L1 mRNA encodes the human C-C motif chemokine ligand 4 like 1 (CCL4L1) protein, a chemokine that can induce chemotaxis of cells expressing CCR5 or CCR1.
Cat. No.: HY-B0155B
CAS No.: 541503-81-5
Synonyms: SCH 417690 malate; SCH-D malate; MK-7690
Vicriviroc (SCH 417690) malate is an orally active CCR5 antagonist with the IC50 of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC50 values of 0.91 nM and 16 nM,,respectively. Vicriviroc malate can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer .
Cat. No.: HY-P991843
Target:
Research Areas:
- 1
- 2
-
-
Protocols
Targeted therapy! The Capetin Prize winning "Click Chemistry" can be used like this!Targeted therapy! The Nobel Prize winning "Click Chemistry" can be used like this!A suitable model is crucial in drug screening experiments. Organs can mimic the three-dimensional functional structure of internal organs, have similar spatial organization to corresponding organs, maintain some key characteristics, and reproduce some physiological functions. They are widely used for modeling and personalized drug screening physiological functions.2025-02-06
