country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P5584

Copy Link Print Information

Heliomicin

Heliomicin is an antifungal peptide that binds to fungus-specific glucosylceramide sphingolipids. Fungal membrane glucosylceramide is required for the activity and growth inhibitory effect of Heliomicin. Heliomicin has no antibacterial activity against Gram-positive and Gram-negative bacteria. Heliomicin can be used in research related to fungal infections.

For research use only. We do not sell to patients.

CAS No.: 391977-03-0
Formula: C₂₀₁H₂₉₇N₆₁O₆₄S₆
Molecular Weight:4784.27

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Heliomicin Chemical Structure

CAS No.: 391977-03-0

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Use of MCE Products

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity
- Description
- In Vitro
Chemical Information
Purity & Documentation
References
Calculators
Help & FAQs
Classifications
Bioz

Biological Activity

Description

In Vitro

Fungal InfectionBacterial InfectionLipid MetabolismOthers

Fungal Infection

Heliomicin inhibits Candida albicans and Candida krusei, but not Candida glabrata, and inhibits Fusarium solani and Aspergillus flavus with MICs of 2.5-5 µM, respectively^[1].
Heliomicin inhibits Candida albicans and Pichia pastoris with an MIC of 2.5 μM, whereas gcs deletion mutants are at least 20-fold more resistant^[2].
Heliomicin inhibits the growth of planktonic Candida albicans and achieves 50% inhibition against two Candida albicans isolates, whereas Candida glabrata is not inhibited^[5].

Fungal Infection

Bacterial Infection

Heliomicin is inactive against bacteria at concentrations up to 50 µM, but inhibits filamentous fungi and yeast, with MICs ranging from 0.1-0.2 µM (N. crassa) to 6-12 µM (A. fumigatus), and 2.5-5 µM for C. albicans and C. neoformans^[3].

Lipid Metabolism

Heliomicin binds Pichia pastoris and soybean glucosylceramide, but does not bind human glucosylceramide or soybean monogalactosyldiacylglycerol, indicating a selective GlcCer interaction distinct from that of RsAFP2^[2].

Others

Heliomicin binds fungal glucosylceramide but does not bind human glucosylceramide^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Related Protocols :

Chemical Information

CAS No. 391977-03-0
Molecular Weight 4784.27
Formula C₂₀₁H₂₉₇N₆₁O₆₄S₆
Sequence

Asp-Lys-Leu-Ile-Gly-Ser-Cys-Val-Trp-Gly-Ala-Val-Asn-Tyr-Thr-Ser-Asp-Cys-Asn-Gly-Glu-Cys-Lys-Arg-Arg-Gly-Tyr-Lys-Gly-Gly-His-Cys-Gly-Ser-Phe-Ala-Asn-Val-Asn-Cys-Trp-Cys-Glu-Thr (disulfide bridge:Cys7-Cys32,Cys18-Cys40,Cys22-Cys42)
Sequence Shortening

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET (disulfide bridge:Cys7-Cys32,Cys18-Cys40,Cys22-Cys42)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (326 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Thevissen K, et al. Therapeutic potential of antifungal plant and insect defensins. Drug discovery today. 2007 Nov;12(21-22):966-71.

[2]. Thevissen K, et al. Defensins from insects and plants interact with fungal glucosylceramides. Journal of Biological Chemistry. 2004 Feb 6;279(6):3900-5.

[3]. Lamberty M, et al. Insect Immunity: isolation from the lepidopteran heliothis virescensof a novel insect defensin with potent antifungal activity. Journal of Biological Chemistry. 1999 Apr 2;274(14):9320-6.

[4]. Lamberty M, et al. Solution structures of the antifungal heliomicin and a selected variant with both antibacterial and antifungal activities. Biochemistry. 2001 Oct 09;40(40):11995-2003. [Content Brief]

[5]. Perez-Rodriguez A, et al. Antimicrobial peptides with anti-Candida activity. International journal of molecular sciences. 2022 Aug 17;23(16):9264.

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

MOQ

Minimum order quantity

100 mg

Get Quote In-stock

Other size

Get Quote