Cat. No.: HY-P2313

Human β-defensin-2

Name: Human β-defensin-2
Brand: MedChemExpress
SKU: HY-P2313
Price: 480.00 USD
Availability: InStock
Rating: 5 (1 reviews)

(Synonyms: HβD-2)

Customer Review

Based on 1 Customer Validation

Human β-defensin-2 (HβD-2) is an orally active, cysteine-rich antimicrobial peptide secreted by epithelial cells, with antibacterial, antiviral, and immunomodulatory activities. Human β-defensin-2 binds to CCR2, reduces NF-κB phosphorylation, increases CREB phosphorylation, inhibits pro-inflammatory cytokines, induces IL-10, and chemotaxes immune cells through CCR2/CCR6. Human β-defensin-2 reduces smoke-induced neutrophil influx in mouse lungs, downregulates pulmonary pro-inflammatory signaling, promotes bacterial clearance, and improves colitis and asthma cytokine/lung resistance. Human β-defensin-2 can be used in research related to diseases such as inflammatory bowel disease, bacterial infections, viral infections, and atopic asthma.

For research use only. We do not sell to patients.

Purity : 98.22%
CAS No.: 372146-20-8
Formula: C₁₈₈H₃₀₅N₅₅O₅₀S₆
Molecular Weight:4328.20

Storage:

Sealed storage, away from moisture.

Powder -80°C, 2 years , -20°C, 1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Human β-defensin-2 Chemical Structure

CAS No.: 372146-20-8

Size

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity
- Description
- IC₅₀ & Target
- In Vitro
- In Vivo
Chemical Information
Solvent & Solubility
- In Vitro
Purity & Documentation
References
Help & FAQs
Classifications
Bioz

Biological Activity

Description

IC₅₀ & Target

^[1]^[5]

NF-κB

TNF-α

IL-10

IL4

IL-5

IL-6

IL-13

All Antibiotic Isoforms :

All NF-κB Isoforms :

All Interleukin Related Isoforms :

All TNF Receptor Isoforms :

In Vitro

OthersCytokines & ChemokinesInnate ImmunityViral Infection

Others

Human β-defensin-2 (hBD2) shows no cytotoxicity to mouse L929 fibroblasts^[1].

Cytokines & Chemokines

Innate Immunity

Human β-defensin-2 (1-100 µg/mL; 24 h) inhibits TLR ligand-induced proinflammatory cytokine release from human PBMCs, including PBMCs from individuals with colitis^[1].
Human β-defensin-2 (10-100 µg/mL; 24 h) attenuates LPS-induced TNF-α production in human Mo-DCs in a CCR2-dependent manner, and modulates cytokine secretion, NF-κB/CREB signaling, and maturation in mouse BM-DCs^[1].

Innate Immunity

Viral Infection

Human β-defensin-2 (HBD2) conjugated to the MERS-CoV spike protein S RBD enhances the expression of antiviral and immune induction-related molecules in THP-1 cells^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

ELISA Assay^[1]

Cell Line:

human mo-DCs and murine BM-DCs
Concentration:

10, 100 µg/mL
Incubation Time:

24 h
Result:

Dose-dependently curbed LPS-induced TNF‑α secretion in human mo-DCs and murine BM-DCs, and its immunomodulatory effect relies on TLR and CCR2 signaling.

In Vivo

Innate ImmunityAdaptive ImmunityViral InfectionBacterial InfectionCytokines & Chemokines

Innate Immunity

Human β-defensin-2 (hBD2) (0.1 mg/kg; s.c.; once daily; from day 1 to day 10) ameliorates DSS colitis by reducing weight loss, disease activity, and mucosal damage in C57BL/6 mice^[1].
Human β-defensin-2 (0.1 mg/kg; s.c.; once daily; starting on day 0 after colitis induction) ameliorates TNBS colitis in BALB/cByJ mice, reducing colon weight and macroscopic and microscopic colon pathology^[1].
Human β-defensin-2 (1.2 mg/kg/day; intranasal or intragastric; daily; for 4 days) attenuates acute cigarette smoke-induced pulmonary neutrophilia and lung neutrophil percentage when administered locally or systemically, without affecting macrophage, dendritic cell, or lymphocyte populations^[3].

Innate Immunity

Adaptive Immunity

Human β-defensin-2 (0.1-1 mg/kg; s.c.; once daily; starting 7 days after T cell transfer and continuing for 86 days) has a protective effect on T cell transfer colitis in mice, improving body weight, DAI, fecal score, colon weight, and histology at 1 mg/kg^[1].

Viral Infection

Adaptive Immunity

Human β-defensin-2 (HBD2) conjugated to the MERS-CoV spike protein S RBD induces higher levels of RBD-specific neutralizing antibody responses in mice compared with S RBD alone^[2].

Innate Immunity

Bacterial Infection

Human β-defensin-2 (1.2 mg/kg/day; intranasal; 5 days per week; during the last 2 weeks of 7-week cigarette smoke exposure) reduces pulmonary neutrophil infiltration in chronically cigarette smoke-exposed C57BL/6N mice without broad immunosuppressive effects, while decreasing pulmonary bacterial load after nontypeable Haemophilus influenzae infection^[3].

Cytokines & Chemokines

Innate Immunity

Human β-defensin-2 (0.4 mg/kg; p.o.; three times daily on days 12 and 13, two doses on day 14; days 12-14) reduces lung resistance and inhibits the release of pulmonary pro-inflammatory cytokines (IL-4, IL-5, IL-6, IL-9, IL-13, TNF-α) in house dust mite-sensitized BALB/c mice after house dust mite challenge^[5].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:

C57BL/6 (male, 7-8 weeks old, nduced by supplementing the drinking water with 2% dextran sodium sulfate for 7 days)^[1]
Dosage:

0.1 mg/kg
Administration:

s.c.; once a day; starting at day 1 until day 10
Result:

Prevented excessive weight loss and improved the DAI.
Scoring of the colonic mucosa for damage revealed significantly reduced mucosal damage in mice given hBD2.
Histological assessment showed hBD2 prevented this loss of crypts and maintained a normal mucosa, comparable to naïve mice.

Animal Model:

BALB/cByJ (male, induced on day 0 by intracolonic (distal) administration of trinitrobenzene sulfonic acid (1 mg in 50% ethanol) under mild anesthesia)^[1]
Dosage:

0.1 mg/kg
Administration:

s.c.; once a day; starting on day 0 after colitis induction
Result:

Mice receiving hBD2 trended toward increased weight gain from day 1-7.
s.c. hBD2 significantly reduced colon weight.
s.c. hBD2 significantly improved the macroscopic and microscopic scores of mouse colons.
Microscopic analysis showed that mice receiving hBD2 had a nearly normal mucosa.

Animal Model:

C.B-17 SCID (female recipient, 8 weeks old, injected 500,000 CD4⁺/CD25⁻ cells (in a final volume of
0.2 ml RPMI 1640 (HY-K3004))^[1]
Dosage:

0.1 mg/kg and 1 mg/kg
Administration:

s.c.; once daily; starting 7 days post T cell transfer for 86 days
Result:

Colitis mice given 1 mg/kg hBD2 s.c. showed less weight loss, improved DAI, and improved stool score compared with the T cell colitis control group.
1 mg/kg hBD2 significantly reduced colon weight.
Only a minor effect of hBD2 on colonic myeloperoxidase activity was observed.
Histological analysis showed less inflammation and tissue disruption in mice given 1 mg/kg hBD2.
The 0.1 mg/kg dose did not improve the outcome of T cell mediated colitis.

Animal Model:

BALB/c (female, 7-8 weeks of age)^[5]
Dosage:

0.4 mg/kg per dose
Administration:

p.o.; days 12 and 13: three times daily; day 14: two doses, last dose 1 h before HDM challenge; days 12-14
Result:

Reduced HDM-triggered lung resistance and lung tissue TNF-α, IL-4, IL-5, IL-6, IL-9, IL-13 secretion in mice; spared IL-33.
Did not alter BALF total/differential cell counts, and impaired lung compliance at high methacholine doses.

Related Protocols :

Chemical Information

CAS No. 372146-20-8
Appearance Solid
Molecular Weight 4328.20
Formula C₁₈₈H₃₀₅N₅₅O₅₀S₆
Color White to off-white
Synonyms

HβD-2
Sequence

Gly-Ile-Gly-Asp-Pro-Val-Thr-Cys-Leu-Lys-Ser-Gly-Ala-Ile-Cys-His-Pro-Val-Phe-Cys-Pro-Arg-Arg-Tyr-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Leu-Pro-Gly-Thr-Lys-Cys-Cys-Lys-Lys-Pro (Disulfide bridge:Cys8-Cys37; Cys15-Cys30; Cys20-Cys38)
Sequence Shortening

GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP (Disulfide bridge:Cys8-Cys37; Cys15-Cys30; Cys20-Cys38)
Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility

In Vitro:

DMSO : ≥ 50 mg/mL (11.55 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

* "≥" means soluble, but saturation unknown.

View the Complete Stock Solution Preparation Table

Preparing Stock Solutions

View the Complete Stock Solution Preparation Table

Concentration Solvent Mass

1 mg

5 mg

10 mg

Concentration

Solvent

Mass

1 mM

0.2310 mL

1.1552 mL

2.3104 mL

5 mM

0.0462 mL

0.2310 mL

0.4621 mL

10 mM

0.0231 mL

0.1155 mL

0.2310 mL

Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.

Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (334 KB)
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Koeninger L, et al. Human β-Defensin 2 Mediated Immune Modulation as Treatment for Experimental Colitis. Frontiers in immunology. 2020;11:93. [Content Brief]

[2]. Kim J, et al. Human β-defensin 2 plays a regulatory role in innate antiviral immunity and is capable of potentiating the induction of antigen-specific immunity. Virology journal. 2018 Aug 08;15(1):124.

[3]. Milad N, et al. Recombinant human β-defensin 2 delivery improves smoking-induced lung neutrophilia and bacterial exacerbation. American journal of physiology. Lung cellular and molecular physiology. 2022 Jul 01;323(1):L37-L47.

[4]. Du Y, et al. A Human β-Defensin-Based Recombinant Protein DF2-HSA Ameliorates Cytokine Storm. Cells. 2026 Jan 21;15(2):202.

[5]. Borchers NS, et al. Human β-Defensin 2 Mutations Are Associated With Asthma and Atopy in Children and Its Application Prevents Atopic Asthma in a Mouse Model. Frontiers in immunology. 2021;12:636061.

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg
DMSO	1 mM	0.2310 mL	1.1552 mL	2.3104 mL	5.7761 mL
	5 mM	0.0462 mL	0.2310 mL	0.4621 mL	1.1552 mL
	10 mM	0.0231 mL	0.1155 mL	0.2310 mL	0.5776 mL

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent:

Product Name:
CAS No.:
Species:
Purity:
Quantity:

Human β-defensin-2

All Antibiotic Isoforms

All NF-κB Isoforms

All Interleukin Related Isoforms

All TNF Receptor Isoforms